Glycoengineering

Overview

Glycosylation is the most common and complex post-translational modification (PTM) of proteins, affecting over 50% of all human proteins. Glycans regulate protein folding, stability, immune recognition, receptor interactions, and pharmacokinetics of therapeutic proteins. Glycoengineering involves rational modification of glycosylation patterns for improved therapeutic efficacy, stability, or immune evasion.

Two major glycosylation types:

• N-glycosylation: Attached to asparagine (N) in the sequon N-X-[S/T] where X ≠ Proline; occurs in the ER/Golgi

• O-glycosylation: Attached to serine (S) or threonine (T); no strict consensus motif; primarily GalNAc initiation

When to Use This Skill

Use this skill when:

• Antibody engineering: Optimize Fc glycosylation for enhanced ADCC, CDC, or reduced immunogenicity

• Therapeutic protein design: Identify glycosylation sites that affect half-life, stability, or immunogenicity

• Vaccine antigen design: Engineer glycan shields to focus immune responses on conserved epitopes

• Biosimilar characterization: Compare glycan patterns between reference and biosimilar

• Drug target analysis: Does glycosylation affect target engagement for a receptor?

• Protein stability: N-glycans often stabilize proteins; identify sites for stabilizing mutations

N-Glycosylation Sequon Analysis

Scanning for N-Glycosylation Sites

N-glycosylation occurs at the sequon N-X-[S/T] where X ≠ Proline.

import re from typing import List, Tuple

def find_n_glycosylation_sequons(sequence: str) -> List[dict]: """ Scan a protein sequence for canonical N-linked glycosylation sequons. Motif: N-X-[S/T], where X ≠ Proline.

Args:
    sequence: Single-letter amino acid sequence

Returns:
    List of dicts with position (1-based), motif, and context
"""
seq = sequence.upper()
results = []
i = 0
while i <= len(seq) - 3:
    triplet = seq[i:i+3]
    if triplet[0] == 'N' and triplet[1] != 'P' and triplet[2] in {'S', 'T'}:
        context = seq[max(0, i-3):i+6]  # ±3 residue context
        results.append({
            'position': i + 1,   # 1-based
            'motif': triplet,
            'context': context,
            'sequon_type': 'NXS' if triplet[2] == 'S' else 'NXT'
        })
        i += 3
    else:
        i += 1
return results

def summarize_glycosylation_sites(sequence: str, protein_name: str = "") -> str: """Generate a research log summary of N-glycosylation sites.""" sequons = find_n_glycosylation_sequons(sequence)

lines = [f"# N-Glycosylation Sequon Analysis: {protein_name or 'Protein'}"]
lines.append(f"Sequence length: {len(sequence)}")
lines.append(f"Total N-glycosylation sequons: {len(sequons)}")

if sequons:
    lines.append(f"\nN-X-S sites: {sum(1 for s in sequons if s['sequon_type'] == 'NXS')}")
    lines.append(f"N-X-T sites: {sum(1 for s in sequons if s['sequon_type'] == 'NXT')}")
    lines.append(f"\nSite details:")
    for s in sequons:
        lines.append(f"  Position {s['position']}: {s['motif']} (context: ...{s['context']}...)")
else:
    lines.append("No canonical N-glycosylation sequons detected.")

return "\n".join(lines)

Example: IgG1 Fc region

fc_sequence = "APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK" print(summarize_glycosylation_sites(fc_sequence, "IgG1 Fc"))

Mutating N-Glycosylation Sites

def eliminate_glycosite(sequence: str, position: int, replacement: str = "Q") -> str: """ Eliminate an N-glycosylation site by substituting Asn → Gln (conservative).

Args:
    sequence: Protein sequence
    position: 1-based position of the Asn to mutate
    replacement: Amino acid to substitute (default Q = Gln; similar size, not glycosylated)

Returns:
    Mutated sequence
"""
seq = list(sequence.upper())
idx = position - 1
assert seq[idx] == 'N', f"Position {position} is '{seq[idx]}', not 'N'"
seq[idx] = replacement.upper()
return ''.join(seq)

def add_glycosite(sequence: str, position: int, flanking_context: str = "S") -> str: """ Introduce an N-glycosylation site by mutating a residue to Asn, and ensuring X ≠ Pro and +2 = S/T.

Args:
    position: 1-based position to introduce Asn
    flanking_context: 'S' or 'T' at position+2 (if modification needed)
"""
seq = list(sequence.upper())
idx = position - 1

# Mutate to Asn
seq[idx] = 'N'

# Ensure X+1 != Pro (mutate to Ala if needed)
if idx + 1 < len(seq) and seq[idx + 1] == 'P':
    seq[idx + 1] = 'A'

# Ensure X+2 = S or T
if idx + 2 < len(seq) and seq[idx + 2] not in ('S', 'T'):
    seq[idx + 2] = flanking_context

return ''.join(seq)

O-Glycosylation Analysis

Heuristic O-Glycosylation Hotspot Prediction

def predict_o_glycosylation_hotspots( sequence: str, window: int = 7, min_st_fraction: float = 0.4, disallow_proline_next: bool = True ) -> List[dict]: """ Heuristic O-glycosylation hotspot scoring based on local S/T density. Not a substitute for NetOGlyc; use as fast baseline.

Rules:
- O-GalNAc glycosylation clusters on Ser/Thr-rich segments
- Flag Ser/Thr residues in windows enriched for S/T
- Avoid S/T immediately followed by Pro (TP/SP motifs inhibit GalNAc-T)

Args:
    window: Odd window size for local S/T density
    min_st_fraction: Minimum fraction of S/T in window to flag site
"""
if window % 2 == 0:
    window = 7
seq = sequence.upper()
half = window // 2
candidates = []

for i, aa in enumerate(seq):
    if aa not in ('S', 'T'):
        continue
    if disallow_proline_next and i + 1 < len(seq) and seq[i+1] == 'P':
        continue

    start = max(0, i - half)
    end = min(len(seq), i + half + 1)
    segment = seq[start:end]
    st_count = sum(1 for c in segment if c in ('S', 'T'))
    frac = st_count / len(segment)

    if frac >= min_st_fraction:
        candidates.append({
            'position': i + 1,
            'residue': aa,
            'st_fraction': round(frac, 3),
            'window': f"{start+1}-{end}",
            'segment': segment
        })

return candidates

External Glycoengineering Tools

1. NetOGlyc 4.0 (O-glycosylation prediction)

Web service for high-accuracy O-GalNAc site prediction:

• URL: https://services.healthtech.dtu.dk/services/NetOGlyc-4.0/

• Input: FASTA protein sequence

• Output: Per-residue O-glycosylation probability scores

• Method: Neural network trained on experimentally verified O-GalNAc sites

import requests

def submit_netoglycv4(fasta_sequence: str) -> str: """ Submit sequence to NetOGlyc 4.0 web service. Returns the job URL for result retrieval.

Note: This uses the DTU Health Tech web service. Results take ~1-5 min.
"""
url = "https://services.healthtech.dtu.dk/cgi-bin/webface2.cgi"
# NetOGlyc submission (parameters may vary with web service version)
# Recommend using the web interface directly for most use cases
print("Submit sequence at: https://services.healthtech.dtu.dk/services/NetOGlyc-4.0/")
return url

Also: NetNGlyc for N-glycosylation prediction

URL: https://services.healthtech.dtu.dk/services/NetNGlyc-1.0/

2. GlycoShield-MD (Glycan Shielding Analysis)

GlycoShield-MD analyzes how glycans shield protein surfaces during MD simulations:

• URL: https://gitlab.mpcdf.mpg.de/dioscuri-biophysics/glycoshield-md/

• Use: Map glycan shielding on protein surface over MD trajectory

• Output: Per-residue shielding fraction, visualization

Installation

pip install glycoshield

Basic usage: analyze glycan shielding from glycosylated protein MD trajectory

glycoshield
--topology glycoprotein.pdb
--trajectory glycoprotein.xtc
--glycan_resnames BGLCNA FUC
--output shielding_analysis/

3. GlycoWorkbench (Glycan Structure Drawing/Analysis)

• URL: https://www.eurocarbdb.org/project/glycoworkbench

• Use: Draw glycan structures, calculate masses, annotate MS spectra

• Format: GlycoCT, IUPAC condensed glycan notation

4. GlyConnect (Glycan-Protein Database)

• URL: https://glyconnect.expasy.org/

• Use: Find experimentally verified glycoproteins and glycosylation sites

• Query: By protein (UniProt ID), glycan structure, or tissue

import requests

def query_glyconnect(uniprot_id: str) -> dict: """Query GlyConnect for glycosylation data for a protein.""" url = f"https://glyconnect.expasy.org/api/proteins/uniprot/{uniprot_id}" response = requests.get(url, headers={"Accept": "application/json"}) if response.status_code == 200: return response.json() return {}

Example: query EGFR glycosylation

egfr_glyco = query_glyconnect("P00533")

5. UniCarbKB (Glycan Structure Database)

• URL: https://unicarbkb.org/

• Use: Browse glycan structures, search by mass or composition

• Format: GlycoCT or IUPAC notation

Key Glycoengineering Strategies

For Therapeutic Antibodies

Goal Strategy Notes

Enhance ADCC Defucosylation at Fc Asn297 Afucosylated IgG1 has ~50× better FcγRIIIa binding

Reduce immunogenicity Remove non-human glycans Eliminate α-Gal, NGNA epitopes

Improve PK half-life Sialylation Sialylated glycans extend half-life

Reduce inflammation Hypersialylation IVIG anti-inflammatory mechanism

Create glycan shield Add N-glycosites to surface Masks vulnerable epitopes (vaccine design)

Common Mutations Used

Mutation Effect

N297A/Q (IgG1) Removes Fc glycosylation (aglycosyl)

N297D (IgG1) Removes Fc glycosylation

S298A/E333A/K334A Increases FcγRIIIa binding

F243L (IgG1) Increases defucosylation

T299A Removes Fc glycosylation

Glycan Notation

IUPAC Condensed Notation (Monosaccharide abbreviations)

Symbol Full Name Type

Glc Glucose Hexose

GlcNAc N-Acetylglucosamine HexNAc

Man Mannose Hexose

Gal Galactose Hexose

Fuc Fucose Deoxyhexose

Neu5Ac N-Acetylneuraminic acid (Sialic acid) Sialic acid

GalNAc N-Acetylgalactosamine HexNAc

Complex N-Glycan Structure

Typical complex biantennary N-glycan: Neu5Ac-Gal-GlcNAc-Man
Man-GlcNAc-GlcNAc-[Asn] Neu5Ac-Gal-GlcNAc-Man/ (±Core Fuc at innermost GlcNAc)

Best Practices

• Start with NetNGlyc/NetOGlyc for computational prediction before experimental validation

• Verify with mass spectrometry: Glycoproteomics (Byonic, Mascot) for site-specific glycan profiling

• Consider site context: Not all predicted sequons are actually glycosylated (accessibility, cell type, protein conformation)

• For antibodies: Fc N297 glycan is critical — always characterize this site first

• Use GlyConnect to check if your protein of interest has experimentally verified glycosylation data

Additional Resources

• GlyTouCan (glycan structure repository): https://glytoucan.org/

• GlyConnect: https://glyconnect.expasy.org/

• CFG Functional Glycomics: http://www.functionalglycomics.org/

• DTU Health Tech servers (NetNGlyc, NetOGlyc): https://services.healthtech.dtu.dk/

• GlycoWorkbench: https://glycoworkbench.software.informer.com/

• Review: Apweiler R et al. (1999) Biochim Biophys Acta. PMID: 10564035

• Therapeutic glycoengineering review: Jefferis R (2009) Nature Reviews Drug Discovery. PMID: 19448661